PDB entry 4kyu

View 4kyu on RCSB PDB site
Description: Crystal Structure of N-terminal G-domain of EngA from Bacillus subtilis
Class: hydrolase
Keywords: Rossmann fold, Ribosome-binding protein, HYDROLASE
Deposited on 2013-05-29, released 2014-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase Der
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: BSU22840, der, engA, yphC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kyua_
  • Chain 'B':
    Compound: GTPase Der
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: BSU22840, der, engA, yphC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kyub_
  • Heterogens: GDP, K, MG, NH4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kyuA (A:)
    mgkpvvaivgrpnvgkstifnriagerisivedtpgvtrdriyssaewlnydfnlidtgg
    idigdepflaqirqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnk
    ldntemraniydfyslgfgepypisgthglglgdlldavaehf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kyuA (A:)
    gkpvvaivgrpnvgkstifnriagerirdriyssaewlnydfnlidtggidigdepflaq
    irqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkldntemraniy
    dfyslgfgepypisgthglglgdlldavaehf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kyuB (B:)
    mgkpvvaivgrpnvgkstifnriagerisivedtpgvtrdriyssaewlnydfnlidtgg
    idigdepflaqirqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnk
    ldntemraniydfyslgfgepypisgthglglgdlldavaehf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kyuB (B:)
    kpvvaivgrpnvgkstifnriaiyssaewnydfnlidtggidigdepflaqirqqaeiam
    deadviifmvngregvtaadeevakilyrtkkpvvlavnkldntemraniydfyslgfge
    pypisgthglglgdlldavaehf