PDB entry 4kyi

View 4kyi on RCSB PDB site
Description: Crystal structure of the phospholipase VipD from Legionella pneumophila in complex with the human GTPase Rab5
Class: protein binding/transport protein
Keywords: Phospholipase, protein binding-transport protein complex
Deposited on 2013-05-29, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 3.08 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vipd
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: vipD, lpg2831
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZRP9 (5-End)
      • expression tag (3-4)
  • Chain 'B':
    Compound: Ras-related protein Rab-5C
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5C, RABL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51148 (Start-169)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4kyib_
  • Chain 'C':
    Compound: vipd
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: vipD, lpg2831
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZRP9 (5-End)
      • expression tag (3-4)
  • Chain 'D':
    Compound: Ras-related protein Rab-5C
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5C, RABL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51148 (Start-169)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4kyid_
  • Chain 'E':
    Compound: vipd
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: vipD, lpg2831
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZRP9 (5-End)
      • expression tag (3-4)
  • Chain 'F':
    Compound: Ras-related protein Rab-5C
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5C, RABL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51148 (Start-169)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4kyif_
  • Chain 'G':
    Compound: vipd
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: vipD, lpg2831
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZRP9 (5-End)
      • expression tag (3-4)
  • Chain 'H':
    Compound: Ras-related protein Rab-5C
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5C, RABL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51148 (Start-169)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d4kyih_
  • Heterogens: EDO, GOL, GNP, MG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kyiB (B:)
    gamgskicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkf
    eiwdtagleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspniviala
    gnkadlaskravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kyiB (B:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kyiD (D:)
    gamgskicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkf
    eiwdtagleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspniviala
    gnkadlaskravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kyiD (D:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4kyiF (F:)
    gamgskicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkf
    eiwdtagleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspniviala
    gnkadlaskravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kyiF (F:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4kyiH (H:)
    gamgskicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkf
    eiwdtagleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspniviala
    gnkadlaskravefqeaqayaddnsllfmetsaktamnvneifmaiakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kyiH (H:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gleryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl