PDB entry 4kxz

View 4kxz on RCSB PDB site
Description: crystal structure of tgfb2 in complex with GC2008.
Class: immune system
Keywords: Cysteine knot, Fab, Various growth functions (TGF-beta), TGF-beta antagonist (GC2008), TGF-beta receptors, immune system
Deposited on 2013-05-28, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.183
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transforming growth factor beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kxza_
  • Chain 'B':
    Compound: Transforming growth factor beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kxzb_
  • Chain 'D':
    Compound: Transforming growth factor beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kxzd_
  • Chain 'E':
    Compound: Transforming growth factor beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kxze_
  • Chain 'H':
    Compound: GC1008 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ (Start-223)
  • Chain 'I':
    Compound: GC1008 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ
    Domains in SCOPe 2.07: d4kxzi1, d4kxzi2
  • Chain 'J':
    Compound: GC1008 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ
  • Chain 'L':
    Compound: GC1008 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ (0-End)
    Domains in SCOPe 2.07: d4kxzl1, d4kxzl2
  • Chain 'M':
    Compound: GC1008 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ (0-End)
    Domains in SCOPe 2.07: d4kxzm1, d4kxzm2
  • Chain 'N':
    Compound: GC1008 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ (Start-223)
  • Chain 'P':
    Compound: GC1008 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ (0-End)
    Domains in SCOPe 2.07: d4kxzp1, d4kxzp2
  • Chain 'Q':
    Compound: GC1008 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KXZ (0-End)
  • Heterogens: MES, PE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kxzA (A:)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kxzB (B:)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kxzD (D:)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kxzE (E:)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4kxzI (I:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kxzI (I:)
    tvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgipd
    rfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4kxzL (L:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kxzL (L:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4kxzM (M:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kxzM (M:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4kxzP (P:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kxzP (P:)
    etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
    drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'Q':
    No sequence available.