PDB entry 4kxo

View 4kxo on RCSB PDB site
Description: Crystal Structure of BBBB at pH 10.0 with MPD as the cryoprotectant
Class: transferase
Keywords: manganese, abo rossmann fold, retaining glycosyltransferase, blood group antigen, metal-binding, glycoprotein, transferase
Deposited on 2013-05-27, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kxoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kxoA (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
    dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
    aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
    eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kxoA (A:)
    pqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaikkyvaflk
    lfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgsmrrmemisdfcerr
    flsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkd
    egdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvl
    speylwdqqllgwpavlrklrftavp