PDB entry 4kx6

View 4kx6 on RCSB PDB site
Description: Plasticity of the quinone-binding site of the complex II homolog quinol:fumarate reductase
Class: oxidoreductase
Keywords: Membrane Protein, Complex II homolog, FrdC-E29L, OXIDOREDUCTASE
Deposited on 2013-05-24, released 2013-07-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli [TaxId:83333]
    Gene: frdA, b4154, JW4115
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Fumarate reductase (Anaerobic), Fe-S subunit
    Species: Escherichia coli [TaxId:595496]
    Gene: frdB, BWG_3868
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kx6b1, d4kx6b2
  • Chain 'C':
    Compound: Fumarate reductase subunit C
    Species: Escherichia coli [TaxId:536056]
    Gene: frdC, EcDH1_3838, ECDH1ME8569_4012
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QU46 (0-129)
      • engineered mutation (28)
  • Chain 'D':
    Compound: Fumarate reductase subunit D
    Species: Escherichia coli [TaxId:83333]
    Gene: frdD, b4151, JW4112
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli [TaxId:83333]
    Gene: frdA, b4154, JW4115
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Fumarate reductase (Anaerobic), Fe-S subunit
    Species: Escherichia coli [TaxId:595496]
    Gene: frdB, BWG_3868
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Fumarate reductase subunit C
    Species: Escherichia coli [TaxId:536056]
    Gene: frdC, EcDH1_3838, ECDH1ME8569_4012
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9QU46 (0-129)
      • engineered mutation (28)
  • Chain 'P':
    Compound: Fumarate reductase subunit D
    Species: Escherichia coli [TaxId:83333]
    Gene: frdD, b4151, JW4112
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, FES, F3S, SF4, MQ7

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kx6B (B:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.