PDB entry 4kvn

View 4kvn on RCSB PDB site
Description: Crystal structure of Fab 39.29 in complex with Influenza Hemagglutinin A/Perth/16/2009 (H3N2)
Class: immune system
Keywords: IgG, antibody, IMMUNE SYSTEM
Deposited on 2013-05-22, released 2013-08-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.205
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:654811]
    Gene: HA, hemagglutinin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kvna1, d4kvna2
  • Chain 'H':
    Compound: Human IgG Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KVN (0-End)
  • Chain 'L':
    Compound: Human IgG Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KVN (0-End)
    Domains in SCOPe 2.04: d4kvnl1, d4kvnl2
  • Heterogens: NAG, PO4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kvnA (A:)
    agstatlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgknctl
    idallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfn
    wtgvtqngtssacirrsknsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpg
    tdkdqiflyaqasgritvstkrsqqtvspnigsrprvrnipsrisiywtivkpgdillin
    stgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacp
    ryvkqntlklatgmrnvpekqtrgifgaiagfiengwegmvdgwygfrhqnsegrgqaad
    lkstqaaidqingklnrligktnekfhqiekefsevegriqdlekyvedtkidlwsynae
    llvalenqhtidltdsemnklfektkkqlrenaedmgngcfkiyhkcdnacigsirngty
    dhdvyrdealnnrfqikgsgrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kvnA (A:)
    atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgknctlidal
    lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
    tqngtssacirrsknsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpgtdkd
    qiflyaqasgritvstkrsqqtvspnigsrprvrnipsrisiywtivkpgdillinstgn
    liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
    qntlklatgmrnvpekqiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingkl
    nrligktnekfhqiekefekyvedtkidlwsynaellvalenqhtidltdsemnklfekt
    kkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4kvnL (L:)
    ivltqspatlsvspgeratlscrasqvishnlawyqqkpgqaprlliygastrasgipar
    fsgsgsgtdytltitslqpedfavyycqhysnwpprltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kvnL (L:)
    ivltqspatlsvspgeratlscrasqvishnlawyqqkpgqaprlliygastrasgipar
    fsgsgsgtdytltitslqpedfavyycqhysnwpprltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg