PDB entry 4kvg

View 4kvg on RCSB PDB site
Description: Crystal structure of RIAM RA-PH domains in complex with GTP bound Rap1
Class: signaling protein
Keywords: Ras-related protein, ubiquitin fold, GTPase, actin polymerization, integrin activation, cell adhesion, RIAM, RAPL, Mst1, PDK, Rap1, Ena/VASP, Profilin, membrane, SIGNALING PROTEIN
Deposited on 2013-05-22, released 2014-03-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rap-1a
    Species: Homo sapiens [TaxId:9606]
    Gene: KREV1, RAP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62834 (1-167)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.04: d4kvga_
  • Chain 'B':
    Compound: Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
    Species: Mus musculus [TaxId:10090]
    Gene: Apbb1ip, Prel1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R5A3 (1-259)
      • expression tag (0)
  • Chain 'C':
    Compound: ras-related protein rap-1a
    Species: Homo sapiens [TaxId:9606]
    Gene: KREV1, RAP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62834 (1-End)
      • engineered mutation (12)
    Domains in SCOPe 2.04: d4kvgc_
  • Chain 'D':
    Compound: Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
    Species: Mus musculus [TaxId:10090]
    Gene: Apbb1ip, Prel1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R5A3 (1-259)
      • expression tag (0)
  • Heterogens: GTP, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kvgA (A:)
    hmreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildta
    gteeftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcd
    ledervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kvgA (A:)
    hmreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildta
    gttamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdled
    ervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kvgC (C:)
    hmreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildta
    gteeftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcd
    ledervvgkeqgqnlarqwcncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kvgC (C:)
    mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdcqqcmleildtag
    trdlymkngqgfalvysitaqstfndlqdlreqilrvkdtedvpmilvgnkcdledervv
    gkeqgqnlarqwcncaflessakskinvneifydlvrqin
    

  • Chain 'D':
    No sequence available.