PDB entry 4kuz

View 4kuz on RCSB PDB site
Description: Crystal structure of anti-emmprin antibody 4A5 Fab in trigonal form
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-05-22, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody 4A5 heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KUZ (0-End)
  • Chain 'L':
    Compound: antibody 4A5 light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KUZ (0-End)
    Domains in SCOPe 2.07: d4kuzl1, d4kuzl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4kuzL (L:)
    divmsqspsslavsvgekvtmsckssqsllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysyptfgagtklelkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kuzL (L:)
    divmsqspsslavsvgekvtmsckssqsllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvkaedlavyycqqyysyptfgagtklelkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnr