PDB entry 4kuc

View 4kuc on RCSB PDB site
Description: Crystal structure of ricin-A chain in complex with the antibody 6C2
Class: hydrolase/immune system
Keywords: RNA-N-glycosidase, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2013-05-21, released 2013-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.241
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuca_
  • Chain 'D':
    Compound: mAb6c2 fab-Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KUC
    Domains in SCOPe 2.07: d4kucd1, d4kucd2
  • Chain 'E':
    Compound: mAb6c2 fab-Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KUC
    Domains in SCOPe 2.07: d4kuce_
  • Chain 'F':
    Compound: mAb6c2 fab-Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KUC
  • Chain 'H':
    Compound: mAb6c2 fab-Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KUC (Start-236)
  • Chain 'I':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kuci_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kucA (A:)
    ifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilv
    elsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafg
    gnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaar
    fqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskf
    svydvsilipiialmvyrcapppssqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kucA (A:)
    qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
    haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
    rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
    egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
    vsilipiialmvyrcappp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kucD (D:)
    metdtlllwvlllwvpgstgdivltqspaslavslgqratisyrasksvsymhwnqqkpg
    qpprlliylgsnlesgvgarfsgsgsgtdftlnihpveeedaatyycqhkreypptfgqg
    tkveikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvgnlqgnsqesv
    teqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kucD (D:)
    divltqspaslavslgqratisyrasksvsymhwnqqkpgqpprlliylgsnlesgvgar
    fsgsgsgtdftlnihpveeedaatyycqhkreypptfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvgnlqgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kucE (E:)
    metdtlllwvlllwvpgstgdivltqspaslavslgqratisyrasksvsymhwnqqkpg
    qpprlliylgsnlesgvgarfsgsgsgtdftlnihpveeedaatyycqhkreypptfgqg
    tkveikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvgnlqgnsqesv
    teqdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kucE (E:)
    divltqspaslavslgqratisyrasksvsymhwnqqkpgqpprlliylgsnlesgvgar
    fsgsgsgtdftlnihpveeedaatyycqhkreypptfgqgtkveikrtv
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4kucI (I:)
    ifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilv
    elsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafg
    gnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaar
    fqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskf
    svydvsilipiialmvyrcapppssqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kucI (I:)
    qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
    haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
    rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
    egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
    vsilipiialmvyrcappp