PDB entry 4ku8

View 4ku8 on RCSB PDB site
Description: Structures of PKGI Reveal a cGMP-Selective Activation Mechanism
Class: signaling protein
Keywords: cyclic nucleotide binding domain, cGMP, SIGNALING PROTEIN
Deposited on 2013-05-21, released 2014-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13976 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ku8b_
  • Chain 'C':
    Compound: cGMP-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1, PRKG1B, PRKGR1A, PRKGR1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13976 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4ku8c1, d4ku8c2
  • Heterogens: GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ku8B (B:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf
    khligglddvsnkayedaeakakyeaeaaffan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ku8B (B:)
    teymeflksvpeeilskladvleethyengeyiirqgargdtffiiskgtvnvtredsps
    edpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ku8C (C:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf
    khligglddvsnkayedaeakakyeaeaaffan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ku8C (C:)
    gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii
    skgtvnvtredvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligg
    ld