PDB entry 4ku4

View 4ku4 on RCSB PDB site
Description: Crystal Structure of a Ras-like Protein from Cryphonectria parasitica in Complex with GDP
Class: signaling protein
Keywords: small G protein, GTP/GDP binding, GTP hydrolysis, SIGNALING PROTEIN
Deposited on 2013-05-21, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.194
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-3 from Cryphonectria parasitica
    Species: Cryphonectria parasitica [TaxId:5116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KU4
    Domains in SCOPe 2.07: d4ku4a_
  • Chain 'B':
    Compound: Ras-3 from Cryphonectria parasitica
    Species: Cryphonectria parasitica [TaxId:5116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KU4
    Domains in SCOPe 2.07: d4ku4b_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ku4A (A:)
    gshmalspgagkitdkiamlgeggvgktsltvnltkhvfsetydptledsyrrqcvidgi
    pshleildtagqeeygalreqwirqnelfvivfdvtrrssfeaaerlfeeviqtkrklde
    trrhpgdrhpddlpfapslvvlvgnkcdldtrrevgtlegsslakklgcgfvetsaklgt
    nveeaffsvvradrrrkrevtdeeqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ku4A (A:)
    agkitdkiamlgeggvgktsltvnltkhvfsetydptledsyrrqcvidgipshleildt
    aggalreqwirqnelfvivfdvtrrssfeaaerlfeeviqtkrkldetpfapslvvlvgn
    kcdldtrrevgtlegsslakklgcgfvetsaklgtnveeaffsvvradrrrkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ku4B (B:)
    gshmalspgagkitdkiamlgeggvgktsltvnltkhvfsetydptledsyrrqcvidgi
    pshleildtagqeeygalreqwirqnelfvivfdvtrrssfeaaerlfeeviqtkrklde
    trrhpgdrhpddlpfapslvvlvgnkcdldtrrevgtlegsslakklgcgfvetsaklgt
    nveeaffsvvradrrrkrevtdeeqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ku4B (B:)
    gagkitdkiamlgeggvgktsltvnltkhvfsetydptledsyrrqcvidgipshleild
    tagygalreqwirqnelfvivfdvtrrssfeaaerlfeeviqtkrkldepfapslvvlvg
    nkcdldtrrevgtlegsslakklgcgfvetsaklgtnveeaffsvvradrrrk