PDB entry 4kty

View 4kty on RCSB PDB site
Description: Fibrin-stabilizing factor with a bound ligand
Class: transferase/transferase inhibitor
Keywords: transglutaminase, COAGULATION, TRANSFERASE, ACYLTRANSFERASE, ligand, calcium ions, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-05-21, released 2013-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.171
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor xiii a chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F13A, F13A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • engineered mutation (655)
      • engineered mutation (657)
    Domains in SCOPe 2.06: d4ktya1, d4ktya2, d4ktya3, d4ktya4
  • Chain 'B':
    Compound: coagulation factor xiii a chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F13A, F13A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • engineered mutation (655)
      • engineered mutation (657)
    Domains in SCOPe 2.06: d4ktyb1, d4ktyb2, d4ktyb3, d4ktyb4
  • Chain 'C':
    Compound: Peptide-like ligand
    Database cross-references and differences (RAF-indexed):
    • PDB 4KTY (0-8)
  • Chain 'D':
    Compound: Peptide-like ligand
    Database cross-references and differences (RAF-indexed):
    • PDB 4KTY (0-8)
  • Heterogens: CA, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ktyA (A:)
    mhhhhhhsetsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlf
    kerwdtnkvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenk
    gtyipvpivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrts
    rnpetdtyilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedg
    ildtclyvmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawt
    gsvdilleyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdif
    leedgnvnskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpas
    vqaikhghvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdg
    mmditdtykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdf
    klsitfrnnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqage
    ymgqlleqaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtviveft
    nplketlrnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssds
    lrhvygeldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ktyA (A:)
    ppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdkyennkl
    ivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgaki
    vmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavy
    ldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgn
    pikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqc
    wvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhc
    wneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfae
    vnsdliyitakkthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlalet
    almygsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkk
    etfdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvltip
    eiiikvrgtqvvgsdmtviveftnplketlrnvwvhldgpgvtrpmkkmfreirpnstvq
    weevcrpwvsghrkliasmssdslrhvygeldvqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ktyB (B:)
    mhhhhhhsetsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlf
    kerwdtnkvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenk
    gtyipvpivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrts
    rnpetdtyilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedg
    ildtclyvmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawt
    gsvdilleyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdif
    leedgnvnskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpas
    vqaikhghvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdg
    mmditdtykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdf
    klsitfrnnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqage
    ymgqlleqaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtviveft
    nplketlrnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssds
    lrhvygeldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ktyB (B:)
    ppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdkyennkl
    ivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgaki
    vmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwceddavy
    ldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdlsgrgn
    pikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvrygqc
    wvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvwnyhc
    wneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapfvfae
    vnsdliyitahvvenvdathigklivtkqiggdgmmditdtykfqegqeeerlaletalm
    ygrsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkket
    fdvtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvltipei
    iikvrgtqvvgsdmtviveftnplketlrnvwvhldgpgvtrpmkkmfreirpnstvqwe
    evcrpwvsghrkliasmssdslrhvygeldvqiqrrps
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.