PDB entry 4ktf

View 4ktf on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis CYP121 in complex with 4,4'-(3-amino-1H-pyrazole-4,5-diyl)diphenol
Class: oxidoreductase
Keywords: P450, Oxidoreductase, cYY, C-C bond formation, Assumed cytosol
Deposited on 2013-05-20, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 121
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv2276, RVBD_2276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ktfa_
  • Heterogens: HEM, SO4, 1TM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ktfA (A:)
    tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
    mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
    dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
    wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsf
    lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
    gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
    llkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ktfA (A:)
    tvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmk
    etaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldn
    litegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwd
    rdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsflt
    talisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkge
    lvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieall
    kkmpgvdlavpidqlvwrtrfqrriperlpvlw