PDB entry 4kt2

View 4kt2 on RCSB PDB site
Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Class: hydrolase
Keywords: Enolase fold, D-MANNONATE DEHYDRATASE, HYDROLASE
Deposited on 2013-05-19, released 2014-05-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.151
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4kt2a1, d4kt2a2, d4kt2a3
  • Chain 'B':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4kt2b1, d4kt2b2, d4kt2b3
  • Chain 'C':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (2)
    Domains in SCOPe 2.06: d4kt2c1, d4kt2c2, d4kt2c3
  • Chain 'D':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4kt2d1, d4kt2d2, d4kt2d3
  • Chain 'E':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4kt2e1, d4kt2e2, d4kt2e3
  • Chain 'F':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4kt2f1, d4kt2f2, d4kt2f3
  • Chain 'G':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4kt2g1, d4kt2g2, d4kt2g3
  • Chain 'H':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4kt2h1, d4kt2h2, d4kt2h3
  • Heterogens: CL, MG, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kt2A (A:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2A (A:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kt2B (B:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2B (B:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgieepadsslpaehvwstekylnhap
    klfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlir
    ehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgf
    hgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghg
    vdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kt2C (C:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2C (C:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgisslpaehvwstekylnhapklfaav
    rerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttp
    laigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdl
    spvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdidee
    laakypyeraslpvnrledgtlwhw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kt2D (D:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2D (D:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaav
    rerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttp
    laigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdl
    spvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdidee
    laakypyeraslpvnrledgtlwhw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kt2E (E:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2E (E:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgiettyyepadsslpaehvwstekyl
    nhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqesl
    rlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhv
    rtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflages
    pghgvdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4kt2F (F:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2F (F:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgidsslpaehvwstekylnhapklfa
    avrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtt
    tplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgpt
    dlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdid
    eelaakypyeraslpvnrledgtlwhw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4kt2G (G:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2G (G:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaav
    rerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttp
    laigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdl
    spvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdidee
    laakypyeraslpvnrledgtlwhw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4kt2H (H:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kt2H (H:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgpadsslpaehvwstekylnhapklf
    aavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlireht
    ttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgp
    tdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdi
    deelaakypyeraslpvnrledgtlwhw