PDB entry 4krn

View 4krn on RCSB PDB site
Description: Nanobody/VHH domain EgA1
Class: immune system
Keywords: nanobody, VHH domain, Camelid VH domain, antibody, IMMUNE SYSTEM
Deposited on 2013-05-16, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.2
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody/VHH domain EgA1
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KRN (0-End)
    Domains in SCOPe 2.07: d4krna1, d4krna2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4krnA (A:)
    qvqlqesggglvqpggslrlscaasgrtfssyamgwfrqapgkqrefvaairwsggytyy
    tdsvkgrftisrdnakttvylqmnslkpedtavyycaatylssdysryalpqrpldydyw
    gqgtqvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4krnA (A:)
    qvqlqesggglvqpggslrlscaasgrtfssyamgwfrqapgkqrefvaairwsggytyy
    tdsvkgrftisrdttvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqg
    tqvtvs