PDB entry 4kr0

View 4kr0 on RCSB PDB site
Description: Complex structure of MERS-CoV spike RBD bound to CD26
Class: hydrolase/viral protein
Keywords: 8-bladed beta-propeller domain, alpha/beta hydrolase domain, blades IV and V, CD26 beta-propeller, HYDROLASE-VIRAL PROTEIN complex
Deposited on 2013-05-15, released 2013-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kr0a1, d4kr0a2
  • Chain 'B':
    Compound: s protein
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: S, spike
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kr0A (A:)
    adgiqsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
    tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
    wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
    lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
    dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
    sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
    ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
    cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskk
    ldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteni
    ivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsygg
    yvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsrae
    nfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiyt
    hmshfikqcfslphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kr0A (A:)
    srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
    ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
    pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
    vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
    clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
    kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
    vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfii
    lnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsm
    vlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshf
    ikqcfslp
    

  • Chain 'B':
    No sequence available.