PDB entry 4kqv

View 4kqv on RCSB PDB site
Description: Topoisomerase iv atp binding domain of francisella tularensis in complex with a small molecule inhibitor
Class: Isomerase
Keywords: ATP-binding, Nucleotide-binding, Topoisomerase, ATP-binding domain, DNA gyrase negatively supercoils closed circular double-stranded DNA, Isomerase
Deposited on 2013-05-15, released 2014-01-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.257
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Topoisomerase IV, subunit B
    Species: Francisella tularensis subsp. holarctica [TaxId:376619]
    Gene: DNA TOPOISOMERASE IV SUBUNIT B PARE, FTL_1726, FTL_1726;
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kqva1, d4kqva2
  • Chain 'B':
    Compound: Topoisomerase IV, subunit B
    Species: Francisella tularensis subsp. holarctica [TaxId:376619]
    Gene: DNA TOPOISOMERASE IV SUBUNIT B PARE, FTL_1726, FTL_1726;
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4kqvb_
  • Heterogens: IOD, DOO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kqvA (A:)
    mqnynaksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlye
    dnsievaddgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvna
    lstrleaeikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnf
    kalknlleakailckaltikysneikkekltwhfetglkgyldhkleaetlpaepfiidn
    fsngdsyldavfcwcedpsesiknsyvnliptpqdgthvtglkngiydaikayieknsls
    vknikitandsfaqlnyvisvkitnpqfagqtkeklsnkdvtnfvatavkdlltiwlnqn
    pdearqiveniskvaqkrinadlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kqvA (A:)
    ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
    addgrgmpvdihpehkmsgielimtklhsggkfsngvgvsvvnalstrleaeikrdgnvy
    hivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailcka
    ltikysneikkekltwhfetglkgyldhklpaepfiidnfsngdsyldavfcwcesikns
    yvnliptpqdgthvtglkngiydaikayieknslsvknikitandsfaqlnyvisvkitn
    pqfagqtkeklsnkdvtnfvatavkdlltiwlnqnpdearqiveniskvaqkrin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kqvB (B:)
    mqnynaksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlye
    dnsievaddgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvna
    lstrleaeikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnf
    kalknlleakailckaltikysneikkekltwhfetglkgyldhkleaetlpaepfiidn
    fsngdsyldavfcwcedpsesiknsyvnliptpqdgthvtglkngiydaikayieknsls
    vknikitandsfaqlnyvisvkitnpqfagqtkeklsnkdvtnfvatavkdlltiwlnqn
    pdearqiveniskvaqkrinadlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kqvB (B:)
    sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva
    ddgrgmpvdihpehkmsgielimtklhsggkvgvsvvnalstrleaeikrdgnvyhivfe
    dgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailckaltiky
    sneikkekltwhfetg