PDB entry 4kq4

View 4kq4 on RCSB PDB site
Description: Crystal structure of Anti-IL-17A antibody CNTO7357
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-05-14, released 2014-03-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CNTO7357 heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KQ4 (0-End)
  • Chain 'L':
    Compound: CNTO7357 light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090, 9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KQ4 (0-213)
    Domains in SCOPe 2.06: d4kq4l1, d4kq4l2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kq4L (L:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdytltissvqaedlalyycqqhystpytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec