PDB entry 4kq3

View 4kq3 on RCSB PDB site
Description: Crystal structure of Anti-IL-17A antibody CNTO3186
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2013-05-14, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.173
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CNTO3186 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KQ3 (0-End)
  • Chain 'L':
    Compound: CNTO3186 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KQ3 (0-End)
    Domains in SCOPe 2.07: d4kq3l1, d4kq3l2
  • Heterogens: GOL, MES, EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4kq3L (L:)
    diqmtqspssvsasvgdrvtitcrasqgisnwlnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqysddptfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kq3L (L:)
    diqmtqspssvsasvgdrvtitcrasqgisnwlnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqysddptfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg