PDB entry 4kp6

View 4kp6 on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 4B (PDE4B) in complex with a [1,3,5]triazine derivative
Class: hydrolase/hydrolase inhibitor
Keywords: PDE4 inhibitor, phosphodiesterase, triazine, neutrophilia, COPD, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-05-13, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: DPDE4, PDE4B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kp6a_
  • Heterogens: 1S1, MG, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kp6A (A:)
    gamgsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllk
    tfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaa
    ifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt
    kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnm
    vhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfi
    dyivhplwetwadlvqpdaqdildtlednrnwyqsmipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kp6A (A:)
    nedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymm
    tledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgv
    snqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidm
    vlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptksle
    lyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadl
    vqpdaqdildtlednrnwyqsmip