PDB entry 4kna

View 4kna on RCSB PDB site
Description: Crystal structure of an N-succinylglutamate 5-semialdehyde dehydrogenase from Burkholderia thailandensis
Class: oxidoreductase
Keywords: NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, structural genomics, NAD-dependent, N-succinyl-L-glutamate, amido acid degradation, AST pathway, aldehyde dehydrogenase, OXIDOREDUCTASE
Deposited on 2013-05-09, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.154
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-succinylglutamate 5-semialdehyde dehydrogenase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: astD, BTH_I1778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4knaa_
  • Chain 'B':
    Compound: N-succinylglutamate 5-semialdehyde dehydrogenase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: astD, BTH_I1778
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4knab_
  • Heterogens: CL, EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4knaA (A:)
    mahhhhhhmtelfidgawvdgagpvfasrnpgtnervwegasasaddveravasarrafa
    awsaldldarctivkrfaallverkealatmigretgkplweartevasmaakvdisita
    yhertgekrapmadgvavlrhrphgvvavfgpynfpghlpnghivpaliagntvvfkpse
    lapgvaratveiwrdaglpagvlnlvqgekdtgvalanhrqidglfftgssdtgtllhkq
    fggrpeivlalemggnnplvvaevedidaavhhaiqsaflsagqrctcarrilvprgafg
    drfvarladvaskitasvfdadpqpfmgavisaraasrlvaaqarlvglgaspiiemkqr
    dpalgfvnaaildvtnvrelpdeehfgplaqivrytdlddaiarandtafglsaglladd
    eqawhtfrrairagivnwnrptngassaapfggagrsgnhrpsayyaadycaypmasves
    aqlqmpaslspglhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4knaA (A:)
    mtelfidgawvdgagpvfasrnpgtnervwegasasaddveravasarrafaawsaldld
    arctivkrfaallverkealatmigretgkplweartevasmaakvdisitayhertgek
    rapmadgvavlrhrphgvvavfgpynfpghlpnghivpaliagntvvfkpselapgvara
    tveiwrdaglpagvlnlvqgekdtgvalanhrqidglfftgssdtgtllhkqfggrpeiv
    lalemggnnplvvaevedidaavhhaiqsaflsagqrctcarrilvprgafgdrfvarla
    dvaskitasvfdadpqpfmgavisaraasrlvaaqarlvglgaspiiemkqrdpalgfvn
    aaildvtnvrelpdeehfgplaqivrytdlddaiarandtafglsaglladdeqawhtfr
    rairagivnwnrptngassaapfggagrsgnhrpsayyaadycaypmasvesaqlqmpas
    lspglhf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4knaB (B:)
    mahhhhhhmtelfidgawvdgagpvfasrnpgtnervwegasasaddveravasarrafa
    awsaldldarctivkrfaallverkealatmigretgkplweartevasmaakvdisita
    yhertgekrapmadgvavlrhrphgvvavfgpynfpghlpnghivpaliagntvvfkpse
    lapgvaratveiwrdaglpagvlnlvqgekdtgvalanhrqidglfftgssdtgtllhkq
    fggrpeivlalemggnnplvvaevedidaavhhaiqsaflsagqrctcarrilvprgafg
    drfvarladvaskitasvfdadpqpfmgavisaraasrlvaaqarlvglgaspiiemkqr
    dpalgfvnaaildvtnvrelpdeehfgplaqivrytdlddaiarandtafglsaglladd
    eqawhtfrrairagivnwnrptngassaapfggagrsgnhrpsayyaadycaypmasves
    aqlqmpaslspglhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4knaB (B:)
    telfidgawvdgagpvfasrnpgtnervwegasasaddveravasarrafaawsaldlda
    rctivkrfaallverkealatmigretgkplweartevasmaakvdisitayhertgekr
    apmadgvavlrhrphgvvavfgpynfpghlpnghivpaliagntvvfkpselapgvarat
    veiwrdaglpagvlnlvqgekdtgvalanhrqidglfftgssdtgtllhkqfggrpeivl
    alemggnnplvvaevedidaavhhaiqsaflsagqrctcarrilvprgafgdrfvarlad
    vaskitasvfdadpqpfmgavisaraasrlvaaqarlvglgaspiiemkqrdpalgfvna
    aildvtnvrelpdeehfgplaqivrytdlddaiarandtafglsaglladdeqawhtfrr
    airagivnwnrptngassaapfggagrsgnhrpsayyaadycaypmasvesaqlqmpasl
    spglhf