PDB entry 4kmt

View 4kmt on RCSB PDB site
Description: Crystal structure of human germline antibody 5-51/O12
Class: immune system
Keywords: immunoglobulin fold, antibody, IMMUNE SYSTEM
Deposited on 2013-05-08, released 2014-03-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain 5-51/CNTO888/IGG1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KMT (0-End)
  • Chain 'L':
    Compound: light chain O12/KAPPA
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KMT (0-213)
    Domains in SCOPe 2.05: d4kmtl1, d4kmtl2
  • Heterogens: NHE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4kmtL (L:)
diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystpltfgqgtkvevkrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec