PDB entry 4kml

View 4kml on RCSB PDB site
Description: Probing the N-terminal beta-sheet conversion in the crystal structure of the full-length human prion protein bound to a Nanobody
Class: membrane protein/protein binding
Keywords: Prion-like fold, antibody, nanobody, MEMBRANE PROTEIN-PROTEIN BINDING complex
Deposited on 2013-05-08, released 2014-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRIP, PRNP, PRP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KML (0-End)
    Domains in SCOPe 2.07: d4kmlb1, d4kmlb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kmlB (B:)
    avqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
    tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kmlB (B:)
    avqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
    tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
    tvs