PDB entry 4kmg

View 4kmg on RCSB PDB site
Description: Crystal structure of cytochrome c6B from Synechococcus sp. WH8102
Class: electron transport
Keywords: cytochrome c6, ELECTRON TRANSPORT
Deposited on 2013-05-08, released 2014-03-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.124
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome C6 (Soluble cytochrome F) (Cytochrome c553)
    Species: Synechococcus sp. [TaxId:84588]
    Gene: NP_897609, petJ, SYNW1516
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kmga_
  • Heterogens: HEM, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kmgA (A:)
    etsgegavlfgqhcagchvnggniirrgknlklatlkrqgldsteaiasiarkgigqmsg
    ygdklgeggdqlvagwileqaqnawtqg