PDB entry 4kky

View 4kky on RCSB PDB site
Description: Crystal structure of N-(1-Pyrene)acetamide labeled P450cam in substrate bound form.
Class: oxidoreductase
Keywords: Pyrene Acetamide labeled, Monooxygenase labeled, electrode surface anchor molecule, thiol alkylation., OXIDOREDUCTASE
Deposited on 2013-05-06, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: camC, camC cyp101, cyp101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-412)
      • engineered mutation (57)
      • engineered mutation (84)
      • engineered mutation (112)
      • engineered mutation (135)
      • engineered mutation (284)
      • engineered mutation (333)
    Domains in SCOPe 2.07: d4kkyx_
  • Heterogens: HEM, 1T4, CAM, K, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4kkyX (X:)
    atetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsng
    ghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfrclanqvvg
    mpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattka
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkyX (X:)
    etiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsnggh
    wiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfrclanqvvgmp
    vvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltd
    qmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmc
    glllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgrilt
    sdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhl
    arreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattka