PDB entry 4kkm

View 4kkm on RCSB PDB site
Description: Crystal structure of a FPP/GFPP synthase (Target EFI-501952) from Zymomonas mobilis, apo structure
Class: transferase
Keywords: isoprenoid synthase, FPP GGPP synthase, Enzyme Function Initiative, structural genomics, TRANSFERASE
Deposited on 2013-05-06, released 2013-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprenyl synthetase
    Species: Zymomonas mobilis subsp. mobilis [TaxId:264203]
    Gene: ZMO0855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kkma_
  • Chain 'B':
    Compound: Polyprenyl synthetase
    Species: Zymomonas mobilis subsp. mobilis [TaxId:264203]
    Gene: ZMO0855
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kkmb_
  • Heterogens: GOL, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kkmA (A:)
    mhhhhhhssgvdlgtenlyfqsmavnlktmmeqvaqdidrlfaeqlpvpedprrrlveam
    ryaaigggkrlrpllvvatcalfnvdreaalrvgmaiecihvyslihddmpcmdnddlrr
    gkptvhkafddasavlsgdalqalafeilseekihtdphvrleliqalaiasgkdgmvgg
    qaidlaaetstvpfdlptitrlqqlktgalfgfcleagaimgrqnkdirdrlkayardig
    lafqiaddlidaegdeavagkavgkdaaagkatflsllglekarsqaqalvdqaiahlsv
    fgseadylrsiaryivardh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkmA (A:)
    mavnlktmmeqvaqdidrlfaeqlpvpedprrrlveamryaaigggkrlrpllvvatcal
    fnvdreaalrvgmaiecihvyslihddmpcmdnddlrrgkptvhkafddasavlsgdalq
    alafeilseekihtdphvrleliqalaiasgkdgmvggqaidlaaetstvpfdlptitrl
    qqlktgalfgfcleagaimgrqnkdirdrlkayardiglafqiaddlidagkatflsllg
    lekarsqaqalvdqaiahlsvfgseadylrsiaryiva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kkmB (B:)
    mhhhhhhssgvdlgtenlyfqsmavnlktmmeqvaqdidrlfaeqlpvpedprrrlveam
    ryaaigggkrlrpllvvatcalfnvdreaalrvgmaiecihvyslihddmpcmdnddlrr
    gkptvhkafddasavlsgdalqalafeilseekihtdphvrleliqalaiasgkdgmvgg
    qaidlaaetstvpfdlptitrlqqlktgalfgfcleagaimgrqnkdirdrlkayardig
    lafqiaddlidaegdeavagkavgkdaaagkatflsllglekarsqaqalvdqaiahlsv
    fgseadylrsiaryivardh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kkmB (B:)
    mavnlktmmeqvaqdidrlfaeqlpvpedprrrlveamryaaigggkrlrpllvvatcal
    fnvdreaalrvgmaiecihvyslihddmpcmdnddlrrgkptvhkafddasavlsgdalq
    alafeilseekihtdphvrleliqalaiasgkdgmvggqaidlaaetstvpfdlptitrl
    qqlktgalfgfcleagaimgrqnkdirdrlkayardiglafqiaddlidaegdgkatfls
    llglekarsqaqalvdqaiahlsvfgseadylrsiaryiv