PDB entry 4kk2

View 4kk2 on RCSB PDB site
Description: Crystal structure of a chimeric FPP/GFPP synthase (TARGET EFI-502313c) from Artemisia spiciformiS (1-72:GI751454468,73-346:GI75233326), apo structure
Class: transferase
Keywords: ISOPRENOID SYNTHASE, ENZYME FUNCTION INITIATIVE, Structural Genomics, TRANSFERASE
Deposited on 2013-05-05, released 2013-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoterpene synthase FDS-5, chloroplastic - Farnesyl diphosphate synthase 1 chimera
    Species: Artemisia spiciformis [TaxId:235357]
    Gene: FDS-5, FDS-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kk2a_
  • Chain 'B':
    Compound: Monoterpene synthase FDS-5, chloroplastic - Farnesyl diphosphate synthase 1 chimera
    Species: Artemisia spiciformis [TaxId:235357]
    Gene: FDS-5, FDS-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kk2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kk2A (A:)
    mgsshhhhhhssglvprgshmtttlssnlnsqfmqvyetlkselihdplfefdddsrqwv
    ermidytvpggkmvrgysvvdsyqllkgeeltddeiflssalgwciewlqayflvlddim
    deshtrrgqpcwfrlpkvgmiaandgillrnhvprilkkhfrgkpyyvdlvdlfnevefq
    tasgqmidlittlvgekdlskyslsihrrivqyktayysfylpvacallmfgedldkhve
    vknvlvemgtyfqvqddyldcfgapevigkigtdiedfkcswlvvkalelaneeqkktlh
    enygkkdpasvakvkevyhtlnlqavfedyeatsykklitsienhpskavqavlksflgk
    iykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kk2A (A:)
    lnsqfmqvyetlkselihdplfefdddsrqwvermidytvpggkmvrgysvvdsyqllkg
    eeltddeiflssalgwciewlqayflvlddimdeshtrrgqpcwfrlpkvgmiaandgil
    lrnhvprilkkhfrgkpyyvdlvdlfnevefqtasgqmidlittlvgekdlskyslsihr
    rivqyktayysfylpvacallmfgedldkhvevknvlvemgtyfqvqddyldcfgapevi
    gkigtdiedfkcswlvvkalelaneeqkktlhenygkkdpasvakvkevyhtlnlqavfe
    dyeatsykklitsienhpskavqavlksflgkiykrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kk2B (B:)
    mgsshhhhhhssglvprgshmtttlssnlnsqfmqvyetlkselihdplfefdddsrqwv
    ermidytvpggkmvrgysvvdsyqllkgeeltddeiflssalgwciewlqayflvlddim
    deshtrrgqpcwfrlpkvgmiaandgillrnhvprilkkhfrgkpyyvdlvdlfnevefq
    tasgqmidlittlvgekdlskyslsihrrivqyktayysfylpvacallmfgedldkhve
    vknvlvemgtyfqvqddyldcfgapevigkigtdiedfkcswlvvkalelaneeqkktlh
    enygkkdpasvakvkevyhtlnlqavfedyeatsykklitsienhpskavqavlksflgk
    iykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kk2B (B:)
    lnsqfmqvyetlkselihdplfefdddsrqwvermidytvpggkmvrgysvvdsyqllkg
    eeltddeiflssalgwciewlqayflvlddimdeshtrrgqpcwfrlpkvgmiaandgil
    lrnhvprilkkhfrgkpyyvdlvdlfnevefqtasgqmidlittlvkdlskyslsihrri
    vqyktayysfylpvacallmfgedldkhvevknvlvemgtyfqvqddyldcfgapevigk
    igtdiedfkcswlvvkalelaneeqkktlhenygkkdpasvakvkevyhtlnlqavfedy
    eatsykklitsienhpskavqavlksflgkiykrqk