PDB entry 4ki5

View 4ki5 on RCSB PDB site
Description: Cystal structure of human factor VIII C2 domain in a ternary complex with murine inhbitory antibodies 3E6 and G99
Class: immune system
Keywords: immunoglobulin fold, discoidin fold, antibody, blood coagulation factor, antigen binding, blood plasma, IMMUNE SYSTEM
Deposited on 2013-05-01, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: murine monoclonal 3e6 fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KI5 (Start-218)
  • Chain 'D':
    Compound: murine monoclonal 3e6 fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KI5 (0-212)
    Domains in SCOPe 2.07: d4ki5d1, d4ki5d2
  • Chain 'E':
    Compound: murine monoclonal g99 fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KI5 (0-223)
  • Chain 'F':
    Compound: murine monoclonal g99 fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4KI5 (0-213)
    Domains in SCOPe 2.07: d4ki5f1, d4ki5f2
  • Chain 'M':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8, F8C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ki5m_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ki5D (D:)
    qivltqspaimsaspgekvtmtcsasstvsymywyqqkpgssprflisdtsnlasgvpvr
    fsgsgsgtsysltisrieaedaatyycqhwssypltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki5D (D:)
    qivltqspaimsaspgekvtmtcsasstvsymywyqqkpgssprflisdtsnlasgvpvr
    fsgsgsgtsysltisrieaedaatyycqhwssypltfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathstspivksfnrnec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ki5F (F:)
    diqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldssvpk
    rfsgsrsgsdysltissldsedfavyyclqyasypytfgggtkveikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki5F (F:)
    diqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldssvpk
    rfsgsrsgsdysltisldsedfavyyclqyasypytfgggtkveikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathspivksfnrnec
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4ki5M (M:)
    mgsshhhhhhssglvprgshmlnscsmplgmeskaisdaqitassyftnmfatwspskar
    lhlqgrsnawrpqvnnpkewlqvdfqktmkvtgvttqgvkslltsmyvkeflisssqdgh
    qwtlffqngkvkvfqgnqdsftpvvnsldpplltrylrihpqswvhqialrmevlgceaq
    dly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki5M (M:)
    csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
    fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
    vnsldpplltrylrihpqswvhqialrmevlgce