PDB entry 4kgq

View 4kgq on RCSB PDB site
Description: Crystal structure of a human light loop mutant in complex with dcr3
Class: immune system
Keywords: light, dcr3, tnf, tnfr, tnf14, structural genomics, psi-biology, new hvem, n-glycosylation, membrane, secreted protein, cytokine, ifn, jelly-roll fold, bind tnf receptor hvem and ltbr, ltbr, protein structure initiative, atoms-to-animals: the immune function network, new york structural genomics research consortium, nysgrc, immune system
Deposited on 2013-04-29, released 2013-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.197
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-157)
      • variant (131)
      • engineered mutation (143-148)
    Domains in SCOPe 2.06: d4kgqa_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-157)
      • variant (131)
      • engineered mutation (143-148)
    Domains in SCOPe 2.06: d4kgqb_
  • Chain 'C':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95407 (Start-165)
      • expression tag (166-169)
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kgqA (A:)
    liqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyy
    iyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssf
    lggvvhleageevvvrvlderlvdytkedrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgqA (A:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcastithglykrtprypeelellvsqqspcgrvwwdssflggvvhleageevvvrvld
    erlvdytkedrsyfgafmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kgqB (B:)
    liqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyy
    iyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssf
    lggvvhleageevvvrvlderlvdytkedrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgqB (B:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcastithglykrtprypeelellvsqqspcgrvwwdssflggvvhleageevvvrvld
    erlvdytkedrsyfgafmv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.