PDB entry 4kgg

View 4kgg on RCSB PDB site
Description: Crystal structure of light mutant2 and dcr3 complex
Class: Cytokine/Signaling Protein
Keywords: LIGHT, DCR3, TNF, TNFR, TNF14, STRUCTURAL GENOMICS, PSI-BIOLOGY, NEW HVEM, N-GLYCOSYLATION, MEMBRANE, SECRETED PROTEIN, CYTOKINE, IFN, JELLY-ROLL FOLD, BIND TNF RECEPTOR HVEM AND LTBR, LTBR, PROTEIN STRUCTURE INITIATIVE, ATOMS-TO-ANIMALS: THE IMMUNE FUNCTION NETWORK, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM, NYSGRC, IMMUNE SYSTEM, Cytokine-Signaling Protein complex
Deposited on 2013-04-29, released 2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.181
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-157)
      • engineered mutation (112-113)
      • engineered mutation (115)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d4kgga_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-157)
      • engineered mutation (112-113)
      • engineered mutation (115)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d4kggb_
  • Chain 'C':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95407 (Start-165)
      • expression tag (166-167)
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 6B
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF6B, DCR3, TR6, UNQ186/PRO212
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kggA (A:)
    liqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyy
    iyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratssssnwfdssf
    lggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kggA (A:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcplastithglykrtprypeelellvsqqspcgsnwfdssflggvvhleageevvvrv
    lderlvrlrdgtrsyfgafmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kggB (B:)
    liqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyy
    iyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratssssnwfdssf
    lggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kggB (B:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcastithglykrtprypeelellvsqqspcgsnwfdssflggvvhleageevvvrvld
    erlvrlrdgtrsyfgafmv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.