PDB entry 4kgd

View 4kgd on RCSB PDB site
Description: High-resolution crystal structure of pyruvate oxidase from L. plantarum in complex with phosphate
Class: oxidoreductase
Keywords: carbanion, structure activity relationship, oxidation-reduction, Umpolung, thiamine diphosphate, reaction intermediate, OXIDOREDUCTASE
Deposited on 2013-04-29, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:644042]
    Gene: JDM1_2870, pox5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kgda1, d4kgda2, d4kgda3
  • Chain 'B':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:644042]
    Gene: JDM1_2870, pox5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kgdb1, d4kgdb2, d4kgdb3
  • Heterogens: FAD, MG, PO4, TDP, GOL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kgdA (A:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgdA (A:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kgdB (B:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgdB (B:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd