PDB entry 4kgb

View 4kgb on RCSB PDB site
Description: Structure of succinyl-CoA: 3-ketoacid CoA transferase from Drosophila melanogaster
Class: transferase
Keywords: protein fold, ketone body catabolic process, TRANSFERASE
Deposited on 2013-04-29, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.207
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-coa:3-ketoacid-coenzyme a transferase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG1140, Dmel_CG1140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kgba1, d4kgba2
  • Chain 'B':
    Compound: succinyl-coa:3-ketoacid-coenzyme a transferase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG1140, Dmel_CG1140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kgbb1, d4kgbb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kgbA (A:)
    gamagkiyesaidavadvqdgaqilfggfgicgipekminalkqkgvknitgvsnnggvd
    dtglgvlikqkqvskvigsyvgentelvrqylegelaveltpqgtlaekiraggagipaf
    ytptgyatlvqeggapikyskdgkveissekkpvkefngknyvmeesifadfafvkaqka
    dplgnlvfnkaarnfnapmcraakitvaeveeivpigalspdeihvpgiyinrifkgtny
    nkrverlritepkdpskpapppnpaqvlreriarrvalefhdgmyanlgigipvlssnyi
    pkgmnvmlqsengilglgpfptkdkvdpdlinagkesvtvvpgasyfgsddsfamirggh
    vditilgamevsatgdlanwmipgklvkgmggamdlvaapgtkviitmehnardgspkil
    dtcslpltgkgvidmiisekavftvekgvgltlievaegytvddiiastgakftvspnlk
    kmgqipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgbA (A:)
    gkiyesaidavadvqdgaqilfggfgicgipekminalkqkgvknitgvsnnggvddtgl
    gvlikqkqvskvigsyvgentelvrqylegelaveltpqgtlaekiraggagipafytpt
    gyatlvqeggapikyskdgkveissekkpvkefngknyvmeesifadfafvkaqkadplg
    nlvfnkaarnfnapmcraakitvaeveeivpigalspdeihvpgiyinrifkgtnynkrv
    erlritepnpaqvlreriarrvalefhdgmyanlgigipvlssnyipkgmnvmlqsengi
    lglgpfptkdkvdpdlinagkesvtvvpgasyfgsddsfamirgghvditilgamevsat
    gdlanwmvkmggamdlvaapgtkviitmehnardgspkildtcslpltgkgvidmiisek
    avftvekgvgltlievaegytvddiiastgakftvspnlkkmgqip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kgbB (B:)
    gamagkiyesaidavadvqdgaqilfggfgicgipekminalkqkgvknitgvsnnggvd
    dtglgvlikqkqvskvigsyvgentelvrqylegelaveltpqgtlaekiraggagipaf
    ytptgyatlvqeggapikyskdgkveissekkpvkefngknyvmeesifadfafvkaqka
    dplgnlvfnkaarnfnapmcraakitvaeveeivpigalspdeihvpgiyinrifkgtny
    nkrverlritepkdpskpapppnpaqvlreriarrvalefhdgmyanlgigipvlssnyi
    pkgmnvmlqsengilglgpfptkdkvdpdlinagkesvtvvpgasyfgsddsfamirggh
    vditilgamevsatgdlanwmipgklvkgmggamdlvaapgtkviitmehnardgspkil
    dtcslpltgkgvidmiisekavftvekgvgltlievaegytvddiiastgakftvspnlk
    kmgqipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgbB (B:)
    gkiyesaidavadvqdgaqilfggfgicgipekminalkqkgvknitgvsnnggvddtgl
    gvlikqkqvskvigsyvgentelvrqylegelaveltpqgtlaekiraggagipafytpt
    gyatlvqeggapikysgkveissekkpvkefngknyvmeesifadfafvkaqkadplgnl
    vfnkaarnfnapmcraakitvaeveeivpigalspdeihvpgiyinrifkgtnynkrver
    lritpnpaqvlreriarrvalefhdgmyanlgigipvlssnyipkgmnvmlqsengilgl
    gpfptkdkvdpdlinagkesvtvvpgasyfgsddsfamirgghvditilgamevsatgdl
    anwmkgmggamdlvaapgtkviitmehnardgspkildtcslpltgkgvidmiisekavf
    tvekgvgltlievaegytvddiiastgakftvspnlkkmgqipv