PDB entry 4kg8

View 4kg8 on RCSB PDB site
Description: Crystal structure of light mutant
Class: cytokine
Keywords: STRUCTURAL GENOMICS, PSI-BIOLOGY, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM, NYSGRC, IMMUNITY, TNF SUPERFAMILY, HVEM, DCR3, N-GLYCOSYLATION, MEMBRANE, SECRETED PROTEIN, CYTOKINE, ATOMS-TO-ANIMALS: THE IMMUNE FUNCTION NETWORK, JELLY-ROLL FOLD, BIND TNF RECEPTOR HVEM AND LTBR, LTBR, Protein Structure Initiative, IFN
Deposited on 2013-04-28, released 2013-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-157)
      • engineered mutation (112-113)
      • engineered mutation (115)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d4kg8a_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-157)
      • engineered mutation (113)
      • engineered mutation (115)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d4kg8b_
  • Chain 'C':
    Compound: Tumor necrosis factor ligand superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-157)
      • engineered mutation (113)
      • engineered mutation (115)
      • engineered mutation (131)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kg8A (A:)
    liqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyy
    iyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratssssnwfdssf
    lggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kg8A (A:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgtithglykrtprypeelellvsqqspsnwfdssflggvvhleageevvvrvlderlgt
    rsyfgafmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kg8B (B:)
    liqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyy
    iyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratssssnwfdssf
    lggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kg8B (B:)
    npaahltganssgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgasti
    thglykrtypeelellvsqqspnwfdssflggvvhleageevvvrvldegtrsyfgafmv
    

  • Chain 'C':
    No sequence available.