PDB entry 4kg6

View 4kg6 on RCSB PDB site
Description: Crystal Structure of AmpC beta-lactamase N152G Mutant from E. coli
Class: Hydrolase
Keywords: cephalosporinase, beta-lactamase, serine hydrolase, Hydrolase
Deposited on 2013-04-28, released 2014-10-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampC, ampA, b4150, JW4111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered mutation (148)
    Domains in SCOPe 2.05: d4kg6a_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampC, ampA, b4150, JW4111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered mutation (148)
    Domains in SCOPe 2.05: d4kg6b_
  • Chain 'C':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampC, ampA, b4150, JW4111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered mutation (148)
    Domains in SCOPe 2.05: d4kg6c_
  • Chain 'D':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:83333]
    Gene: ampC, ampA, b4150, JW4111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00811 (0-357)
      • engineered mutation (148)
    Domains in SCOPe 2.05: d4kg6d_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kg6A (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyagssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kg6B (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyagssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kg6C (C:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyagssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kg6D (D:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyagssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq