PDB entry 4kfz

View 4kfz on RCSB PDB site
Description: Crystal structure of LMO2 and anti-LMO2 VH complex
Class: transcription
Keywords: ONCOPROTEIN, T-CELL LEUKEMIA, PROTO-ONCOGENE, TRANSCRIPTION, DEVELOPMENTAL PROTEIN, LIM domain, transcription factor, nucleus
Deposited on 2013-04-28, released 2014-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lmo-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LMO2, RBTN2, RBTNL1, RHOM2, TTG2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: lmo-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LMO2, RBTN2, RBTNL1, RHOM2, TTG2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Anti-LMO2 VH
    Species: Homo sapiens [TaxId:9606]
    Gene: Anti-LMO2 VH
    Database cross-references and differences (RAF-indexed):
    • PDB 4KFZ (Start-128)
    Domains in SCOPe 2.07: d4kfzc_
  • Chain 'D':
    Compound: Anti-LMO2 VH
    Species: Homo sapiens [TaxId:9606]
    Gene: Anti-LMO2 VH
    Database cross-references and differences (RAF-indexed):
    • PDB 4KFZ
    Domains in SCOPe 2.07: d4kfzd_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kfzC (C:)
    ggsmaevqllesggglvqpggslrlscaasgfsfshspmnwvrqapgkglewvsyisyns
    ssiyyadsvkgrftisrdnskntlylqmnslraedtavyycargltesleltadwfdywg
    qgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kfzC (C:)
    smaevqllesggglvqpggslrlscaasgfsfshspmnwvrqapgkglewvsyisynsss
    iyyadsvkgrftisrdnskntlylqmnslraedtavyycargltesleltadwfdywgqg
    tlvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kfzD (D:)
    ggsmaevqllesggglvqpggslrlscaasgfsfshspmnwvrqapgkglewvsyisyns
    ssiyyadsvkgrftisrdnskntlylqmnslraedtavyycargltesleltadwfdywg
    qgtlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kfzD (D:)
    gsmaevqllesggglvqpggslrlscaasgfsfshspmnwvrqapgkglewvsyisynss
    siyyadsvkgrftisrdnskntlylqmnslraedtavyycargltesleltadwfdywgq
    gtlvtvs