PDB entry 4kem

View 4kem on RCSB PDB site
Description: Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site
Class: lyase
Keywords: TARTRATE DEHYDRATASE, MANDELATE RACEMASE FAMILY, ENZYME FUNCTION INITIATIVE, EFI, Structural Genomics, LYASE
Deposited on 2013-04-25, released 2013-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.166
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Azospirillum sp. B510 [TaxId:137722]
    Gene: AZL_d02920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kema1, d4kema2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Azospirillum sp. B510 [TaxId:137722]
    Gene: AZL_d02920
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4kemb1, d4kemb2
  • Heterogens: MG, CL, AKR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kemA (A:)
    mriveireqtagiksdianafidfsqmtcsvvavvtdvvrdgkpvigygfnsngryaagg
    llrerfiprlmsaapdslldetgenldpfriwtrlmtnekpgghgersvavgtidmavwd
    avakiagvplyrlladrfrggvaddgvwvyaaggyyypgkdvkalqdemrsyrdrgyrvv
    kmkiggaplaedlrridavlevvgsgdnlcvdangrfdidtaiaygealkpyglfwyeea
    gdpldyalqaelakhydrpmatgenlfshqdarnlirhggmrpdrdwlqfdcalsyglve
    ylrtldmlkengwssrrvvphgghqmslniaaglhlggnesypdvfkpfcgfadgiaved
    grvrlpdlpgvgfeakselfatmsgllgtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kemB (B:)
    mriveireqtagiksdianafidfsqmtcsvvavvtdvvrdgkpvigygfnsngryaagg
    llrerfiprlmsaapdslldetgenldpfriwtrlmtnekpgghgersvavgtidmavwd
    avakiagvplyrlladrfrggvaddgvwvyaaggyyypgkdvkalqdemrsyrdrgyrvv
    kmkiggaplaedlrridavlevvgsgdnlcvdangrfdidtaiaygealkpyglfwyeea
    gdpldyalqaelakhydrpmatgenlfshqdarnlirhggmrpdrdwlqfdcalsyglve
    ylrtldmlkengwssrrvvphgghqmslniaaglhlggnesypdvfkpfcgfadgiaved
    grvrlpdlpgvgfeakselfatmsgllgtr