PDB entry 4kea

View 4kea on RCSB PDB site
Description: Crystal structure of D196N mutant of Monoglyceride lipase from Bacillus sp. H257 in space group P212121
Class: hydrolase
Keywords: alpha/beta hydrolase, monoglyceride lipase, HYDROLASE
Deposited on 2013-04-25, released 2013-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4keaa_
  • Chain 'B':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597 (Start-269)
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4keab_
  • Chain 'C':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4keac_
  • Chain 'D':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4kead_
  • Chain 'E':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597 (Start-269)
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4keae_
  • Chain 'F':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597 (Start-269)
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4keaf_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4keaA (A:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4keaA (A:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaiaagmtgggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakl
    drivcpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiers
    leffakha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4keaB (B:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4keaB (B:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaiaaelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcp
    alifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffak
    hag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4keaC (C:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4keaC (C:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaiaagmgelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldri
    vcpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiierslef
    fakha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4keaD (D:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4keaD (D:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaiaaggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldriv
    cpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleff
    akha
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4keaE (E:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4keaE (E:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaiaalpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcpa
    lifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakh
    ag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4keaF (F:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4keaF (F:)
    eqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthy
    edmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaa
    vdipaialpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcpali
    fvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakhag