PDB entry 4ke7

View 4ke7 on RCSB PDB site
Description: Crystal structure of Monoglyceride lipase from Bacillus sp. H257 in complex with an 1-myristoyl glycerol analogue
Class: hydrolase
Keywords: alpha/beta hydrolase fold, monoglyceride lipase, HYDROLASE
Deposited on 2013-04-25, released 2013-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ke7a_
  • Chain 'B':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ke7b_
  • Heterogens: 1QX, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ke7A (A:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdedhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke7A (A:)
    mseqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgt
    hyedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpin
    aavdipaiaagmlpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldriv
    cpalifvsdedhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleff
    akhag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ke7B (B:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdedhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke7B (B:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaiaagpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcpa
    lifvsdedhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakh
    ag