PDB entry 4ke6

View 4ke6 on RCSB PDB site
Description: Crystal structure D196N mutant of Monoglyceride lipase from Bacillus sp. H257 in complex with 1-rac-lauroyl glycerol
Class: hydrolase
Keywords: alpha/beta hydrolase fold, Monoglyceride Lipase, Monoglycerides, HYDROLASE
Deposited on 2013-04-25, released 2013-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597 (20-End)
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4ke6a_
  • Chain 'B':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4ke6b_
  • Chain 'C':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4ke6c_
  • Chain 'D':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4ke6d_
  • Chain 'E':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4ke6e_
  • Chain 'F':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82597
      • engineered mutation (215)
    Domains in SCOPe 2.06: d4ke6f_
  • Heterogens: 1QW, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ke6A (A:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke6A (A:)
    mseqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgt
    hyedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpin
    aavdipaiaagmggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakld
    rivcpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersl
    effakha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ke6B (B:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke6B (B:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaiaelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcpa
    lifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakh
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ke6C (C:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke6C (C:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipaelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcpali
    fvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ke6D (D:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke6D (D:)
    seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
    yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
    avdipapryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcpalifv
    sdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakha
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ke6E (E:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke6E (E:)
    qypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthye
    dmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaav
    dipadlknpdvkelayektptasllqlarlmaqtkakldrivcpalifvsdenhvvppgn
    adiifqgisstekeivrlrnsyhvatldydqpmiiersleffakha
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ke6F (F:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdenhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ke6F (F:)
    qypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthye
    dmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaav
    dipasdlknpdvkelayektptasllqlarlmaqtkakldrivcpalifvsdenhvvppg
    nadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakha