PDB entry 4kbb

View 4kbb on RCSB PDB site
Description: Structure of Botulinum neurotoxin B binding domain in complex with both synaptotagmin II and GD1a
Class: Signaling Protein/Toxin
Keywords: Toxin binding domain, Synaptotagmin and ganglioside, Signaling Protein-Toxin complex
Deposited on 2013-04-23, released 2013-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.159
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbba1, d4kbba2
  • Chain 'B':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4kbbb1, d4kbbb2
  • Chain 'C':
    Compound: Synaptotagmin-2
    Species: Mus musculus [TaxId:10090]
    Gene: Syt2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Synaptotagmin-2
    Species: Mus musculus [TaxId:10090]
    Gene: Syt2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kbbA (A:)
    mgsshhhhhhssglvprgshmasmnseilnniilnlrykdnnlidlsgygakvevydgve
    lndknqfkltssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneyti
    incmknnsgwkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnln
    nakiyingklesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnie
    erykiqsyseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnsk
    yinyrdlyigekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeek
    lflapisdsdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfee
    ykdyfciskwylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbbA (A:)
    nniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifns
    vfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingk
    tksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeii
    fkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseylkdfwgnplmynkeyymf
    nagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigekfiirrksdivrkedyiy
    ldffnlnqewrvytykyfkkeeeklflapisdsdefyntiqikeydeqptyscqllfkkd
    eestdeigligihrfyeeykdyfciskwylkevkrkpynlklgcnwqfipkdegwte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kbbB (B:)
    mgsshhhhhhssglvprgshmasmnseilnniilnlrykdnnlidlsgygakvevydgve
    lndknqfkltssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneyti
    incmknnsgwkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnln
    nakiyingklesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnie
    erykiqsyseylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnsk
    yinyrdlyigekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeek
    lflapisdsdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfee
    ykdyfciskwylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kbbB (B:)
    nniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifns
    vfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingk
    tksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeii
    fkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseylkdfwgnplmynkeyymf
    nagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigekfiirrkdivrkedyiyl
    dffnlnqewrvytykyfkkeeeklflapisdsdefyntiqikeydeqptyscqllfkkde
    estdeigligihrfyeseykdyfciskwylkevkrkpynlklgcnwqfipkdegwte
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.