PDB entry 4kb9

View 4kb9 on RCSB PDB site
Description: Crystal structure of wild-type HIV-1 protease with novel tricyclic P2-ligands GRL-0739A
Class: Hydrolase/Hydrolase Inhibitor
Keywords: spartic acid protease, HIV-1 protease inhibitor GRL-0739A, a Novel Tricyclic P2-ligand,, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2013-04-23, released 2013-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.142
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SSI0 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d4kb9a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SSI0 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d4kb9b_
• Heterogens: G79, CL, ACT, NA, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4kb9A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4kb9B (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf