PDB entry 4kax

View 4kax on RCSB PDB site
Description: Crystal structure of the Grp1 PH domain in complex with Arf6-GTP
Class: protein binding/signaling protein
Keywords: PH domain, Phosphoinositides, PROTEIN BINDING-SIGNALING PROTEIN complex
Deposited on 2013-04-23, released 2013-08-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62330 (8-167)
      • expression tag (6-7)
      • engineered mutation (61)
      • expression tag (168)
    Domains in SCOPe 2.03: d4kaxa_
  • Chain 'B':
    Compound: Cytohesin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CYTH3, ARNO3, GRP1, PSCD3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, CIT, GOL, K, 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4kaxA (A:)
hhhhhhgsmrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvg
gldkirplwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqd
lpdamkpheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyn

    Sequence, based on observed residues (ATOM records): (download) 
    >4kaxA (A:)
gsmrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyn

  • Chain 'B':
    No sequence available.