PDB entry 4ka5

View 4ka5 on RCSB PDB site
Description: Structure of D141A variant of B. pseudomallei KatG
Class: oxidoreductase
Keywords: catalase-peroxidase, KatG, D141A variant, OXIDOREDUCTASE
Deposited on 2013-04-22, released 2014-03-19
Made obsolete by 5syh on 2016-09-07

The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.158
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSL2865, katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (0-713)
      • engineered mutation (106)
    Domains in SCOPe 2.06: d4ka5a1, d4ka5a2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSL2865, katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q939D2 (0-713)
      • engineered mutation (106)
    Domains in SCOPe 2.06: d4ka5b1, d4ka5b2
  • Heterogens: NA, CL, HEM, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ka5A (A:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpananldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ka5B (B:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpananldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla