PDB entry 4ka3

View 4ka3 on RCSB PDB site
Description: Structure of MAP kinase in complex with a docking peptide
Class: transferase/protein binding
Keywords: kinase domain, phosphorylation, KIM, TRANSFERASE-PROTEIN BINDING complex
Deposited on 2013-04-22, released 2013-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-18, with a file datestamp of 2013-12-13.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.227
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ka3a_
  • Chain 'B':
    Compound: tgf-beta-activated kinase 1 and map3k7-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TAB1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ka3A (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ka3A (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglaatrwyrapeim
    lnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisses
    arnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvpppld
    

  • Chain 'B':
    No sequence available.