PDB entry 4k9l

View 4k9l on RCSB PDB site
Description: Crystal Structure of the His281Thr mutant of Benzoylformate Decarboxylase from Pseudomonas putida
Class: lyase
Keywords: Thiamine Diphosphate, LYASE
Deposited on 2013-04-20, released 2013-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.142
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906 (0-524)
      • engineered mutation (279)
    Domains in SCOPe 2.07: d4k9la1, d4k9la2, d4k9la3
  • Heterogens: TZD, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k9lA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfrytqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvsphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9lA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfrytqgqylkpgtrlisvtcdple
    aarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdtlnd
    mapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperqvia
    vigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgidfr
    alakgygvqalkadnleqlkgslqealsakgpvlievstvsp