PDB entry 4k9e

View 4k9e on RCSB PDB site
Description: Crystal structure of KIT D4D5 fragment in complex with anti-Kit antibodies Fab79D
Class: immune system
Keywords: receptor tyrosine kinase (RTK), IgG, Fab, IMMUNE SYSTEM
Deposited on 2013-04-19, released 2013-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Mast/stem cell growth factor receptor Kit
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT, SCFR
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K9E (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K9E
    Domains in SCOPe 2.07: d4k9el1, d4k9el2, d4k9el3
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4k9eL (L:)
    diqmtqspsslsasvgdrvtitcrasqrglrnvavawyqqkpgkapklliysasslysgv
    psrfsgsrsgtdftltisslqpedfatyycqqwavhslitfgqgtkveikrtvaapsvfi
    fppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslss
    tltlskadyekhkvyacevthqglsspvtksfnrgecggsdykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k9eL (L:)
    iqmtqspsslsasvgdrvtitcrasqrglrnvavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqwavhslitfgqgtkveikrtvaapsvfif
    ppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgeykdddd