PDB entry 4k8m

View 4k8m on RCSB PDB site
Description: High resolution structure of M.tb NRDH
Class: electron transport
Keywords: thioredoxin, redoxin, thioredoxin reductase, ribonucleotide reductase, electron transport
Deposited on 2013-04-18, released 2014-06-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 0.87 Å
R-factor: 0.14
AEROSPACI score: 1.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin-like protein nrdh
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv3053c, RVBD_3053c
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YB06 (0-77)
      • expression tag (78-83)
    Domains in SCOPe 2.08: d4k8ma1, d4k8ma2
  • Heterogens: NO3, CL, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4k8mA (A:)
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvvagndhw
sgfrpdrikalagaaltahhhhhh