PDB entry 4k81

View 4k81 on RCSB PDB site
Description: Crystal structure of the Grb14 RA and PH domains in complex with GTP-loaded H-Ras
Class: signaling protein
Keywords: adaptor protein, signaling protein
Deposited on 2013-04-17, released 2013-09-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Growth factor receptor-bound protein 14
  Species: Homo sapiens [TaxId:9606]
  Gene: GRB14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14449 (7-257)
    • engineered mutation (173-174)
• Chain 'B':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Gene: HRAS, HRAS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (5-170)
    • expression tag (0-4)
    • engineered mutation (16)
  Domains in SCOPe 2.03: d4k81b_
• Chain 'C':
  Compound: Growth factor receptor-bound protein 14
  Species: Homo sapiens [TaxId:9606]
  Gene: GRB14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14449 (7-257)
    • engineered mutation (173-174)
• Chain 'D':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Gene: HRAS, HRAS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (5-170)
    • expression tag (0-4)
    • engineered mutation (16)
  Domains in SCOPe 2.03: d4k81d_
• Chain 'E':
  Compound: Growth factor receptor-bound protein 14
  Species: Homo sapiens [TaxId:9606]
  Gene: GRB14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14449 (7-257)
    • engineered mutation (173-174)
• Chain 'F':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Gene: HRAS, HRAS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (5-170)
    • expression tag (0-4)
    • engineered mutation (16)
  Domains in SCOPe 2.03: d4k81f_
• Chain 'G':
  Compound: Growth factor receptor-bound protein 14
  Species: Homo sapiens [TaxId:9606]
  Gene: GRB14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14449 (7-257)
    • engineered mutation (173-174)
• Chain 'H':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Gene: HRAS, HRAS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (5-170)
    • expression tag (0-4)
    • engineered mutation (16)
  Domains in SCOPe 2.03: d4k81h_
• Heterogens: GOL, GTP, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4k81B (B:)
  gamgsmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
  ldtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
  nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4k81D (D:)
  gamgsmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
  ldtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
  nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4k81F (F:)
  gamgsmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
  ldtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
  nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4k81H (H:)
  gamgsmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldi
  ldtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvg
  nkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh