PDB entry 4k7v

View 4k7v on RCSB PDB site
Description: OYE1-W116A complexed with (R)-carvone
Class: oxidoreductase
Keywords: Old Yellow Enzyme, carvone, oxidoreductase, TIM barrel, NADPH dehydrogenase 1
Deposited on 2013-04-17, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.149
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadph dehydrogenase 1
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: OYE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02899 (Start-399)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d4k7va_
  • Heterogens: FMN, MG, CL, 07V, NA, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k7vA (A:)
    msfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytq
    raqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlavlg
    waafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakn
    siaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighek
    vglrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflte
    gegeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdr
    lekglplnkydrdtfyqmsahgyidyptyeealklgwdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k7vA (A:)
    sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
    aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlavlgw
    aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
    iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
    glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
    egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
    ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk