PDB entry 4k7m

View 4k7m on RCSB PDB site
Description: Crystal structure of RNase S variant (K7C/Q11C) with bound mercury ions
Class: hydrolase
Keywords: HYDROLASE, S-peptide
Deposited on 2013-04-17, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-118)
      • engineered mutation (6)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d4k7ma_
  • Heterogens: HG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k7mA (A:)
    ketaaacferchmdssssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvac
    kngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k7mA (A:)
    ketaaacferchmdsssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvack
    ngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv